PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00026.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 437aa    MW: 47817.5 Da    PI: 6.7099
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00026.1.g00140.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.51.7e-24140189151
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   k +++WtpeLH+rFv+aveqL G++kA+P++ile+m+++gLt+++++SHLQ
  Zjn_sc00026.1.g00140.1.am.mk 140 KRKVNWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIEGLTRHNIASHLQ 189
                                   5799*****************.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.14137196IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-22138189IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23140190IPR006447Myb domain, plants
SuperFamilySSF466891.13E-14140189IPR009057Homeodomain-like
PfamPF002492.4E-7142189IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
LDVDVGFPTS TDCGGVDEFM AVDGDNLLEY IDFTCCDVVP SFFDADGDIL PDLETELLAE  60
FEDHDDKENE DEKWLLLEEE EDHRKKRSGS SEDEVLLSAA TTEDSAAAAG SSSDTSKSSS  120
VSAEGQISKK KKSSKKSNGK RKVNWTPELH RRFVQAVEQL GIDKAVPSRI LEIMGIEGLT  180
RHNIASHLQV NGVVSIRFVY NIFLGPKRAK RRRQGGKHLM AREAEAASWA QKRQMYAAAA  240
VGTPRTTKDV MPPAAPRPYW AVPTSSTIGF PPPPFLHVWG HPPTAMEAAV PMLPVWPRHL  300
APPRPWAPLD PAVFWHQQYN GARKWGPQAV PQMPPAAAAA MLPRFPAPVP GTMMPHPMYR  360
PRMPPPPQIT GSTSQLQLDA HPSKESIDAA IGDVLVKPWL PLPLGLKPPS LDSVMSELHK  420
QGIPKIPPAA TATGRQP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205211PKRAKRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519495e-61JF951949.1 Triticum aestivum clone TaMYB66 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008673438.11e-114PREDICTED: golden plant2 isoform X1
SwissprotQ5NAN53e-92GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLA0A0A9LLL41e-116A0A0A9LLL4_ARUDO; Uncharacterized protein
STRINGGRMZM2G087804_P031e-113(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-41GBF's pro-rich region-interacting factor 1